PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G085900.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 226aa    MW: 25647.5 Da    PI: 5.8204
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G085900.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.5e-182376356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Aqcoe3G085900.3.p 23 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARVLGLQPRQIAIWFQNRRARWK 76
                       456899***********************************************9 PP

2HD-ZIP_I/II130.66.1e-4222114193
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrl+ eqvk+LE++Fe  +kLeperK++lar Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr++da+k++n++L++++++L++e++
  Aqcoe3G085900.3.p  22 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARVLGLQPRQIAIWFQNRRARWKTKQLEKDYDILKRQFDAVKDNNDALQAQNKKLQAEIM 113
                        69**************************************************************************************9997 PP

        HD-ZIP_I/II  93 e 93 
                        +
  Aqcoe3G085900.3.p 114 A 114
                        5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-191480IPR009057Homeodomain-like
PROSITE profilePS5007117.1671878IPR001356Homeobox domain
SMARTSM003892.6E-172182IPR001356Homeobox domain
CDDcd000863.57E-152379No hitNo description
PfamPF000463.7E-152376IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-192585IPR009057Homeodomain-like
PRINTSPR000311.8E-54958IPR000047Helix-turn-helix motif
PROSITE patternPS0002705376IPR017970Homeobox, conserved site
PRINTSPR000311.8E-55874IPR000047Helix-turn-helix motif
PfamPF021836.1E-1678117IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSFSGVENGD EDLSDDGSQA GEKKRRLNME QVKTLEKNFE LGNKLEPERK MQLARVLGLQ  60
PRQIAIWFQN RRARWKTKQL EKDYDILKRQ FDAVKDNNDA LQAQNKKLQA EIMALKGGEP  120
TESINLNKET EGSCSNRSEN SSEINLDISR TPAIDSPLSS NPSRPLFPTS MRPASIVQLL  180
QSSSRADAHC QKSQNPTQEE SICHIFNAID DQPSFWPWSE NQQYH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17078RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010242413.11e-130PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-90ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0S2T0071e-124A0A0S2T007_VITVI; Homodomain-leucine zipper protein ATHB-13-like protein
TrEMBLF6HPE21e-124F6HPE2_VITVI; Putative uncharacterized protein
STRINGVIT_01s0026g01950.t011e-124(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.18e-92HD-ZIP family protein